site stats

Them4 antibody

SpletBioGRID Interaction 286795 Between THEM4 And AKT1. Affinity Capture-Western . An interaction is inferred when a bait protein is affinity captured from cell extracts by either polyclonal antibody or epitope tag and the associated interaction partner identified by Western blot with a specific polyclonal antibody or second epitope tag. SpletTHEM4 (AAH65277.1, 1 a.a. ~ 240 a.a) full-length human protein. Sequence MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT

- THEM4 antibodies Antibodypedia

SpletAcyl CoA thioesterase THEM4 antibody; Acyl coenzyme A thioesterase THEM4 antibody; C terminal modulator protein antibody; Carboxyl-terminal modulator protein antibody; … SpletWB analysis of mouse skeletal muscle using 14692-1-AP. mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14692-1-AP (CTMP antibody) … fred berry movies and tv shows https://aminolifeinc.com

THEM4 antibody Western SAB1401968 - Sigma-Aldrich

SpletTHEM4 Polyclonal Antibody. 770-729-2992. Cart Is Empty SpletMatched Swine Antibody Pairs Matched Chicken Antibody Pairs Services Magnetic beads Magnetic beads for protein/antibody and DNA purification, immunoprecipitation, CHIP … SpletTHEM4, also known as CTMP, binds specifically to the carboxy-terminal regulatory domain of PKB/Akt at the plasma membrane and acts as a negative regulator, reversing the phenotype of v-Akt-transformed cells. Hypermethylation of the THEM4 promoter and transcriptional downregulation of the gene has been reported in multiple glioblastomas ... blerwitch le furax

THEM4 Gene - GeneCards THEM4 Protein THEM4 Antibody

Category:THEM4 Polyclonal Antibody Invitrogen PA5-20773 product …

Tags:Them4 antibody

Them4 antibody

Anti-THEM4 Antibodies Invitrogen

Spleting Technology), rabbit anti-HA-tag (1:1000; Cell Signaling Technology), and mouse anti- -actin monoclonal antibody (1:5000; Cell Signaling Technology). SpletBoster Bio Anti-THEM4 Antibody Picoband™ catalog # A07814-1. Tested in ELISA, Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human.

Them4 antibody

Did you know?

Splet03. jul. 2024 · Product Name: THEM4 AntibodyIsotype: Rabbit IgSpecies Reactivity: H/M/RWeb Site：MedchemexpressFormat: Each vial contains 0.1 ml IgG in PBS pH 7.4 … SpletAnti-them4 Antibody Products. Anti-them4 Antibody Products. Products (77) Write a Review; Company View; Product View; Your search returned 77 them4 Antibodies across 17 suppliers. Showing 17 of 17 suppliers (77 products total) > >> Select All. Select up to 5 products from below to compare or request more information.

SpletCTMP / THEM4 Antibody (Internal), Rabbit Polyclonal Antibody validated in WB, IHC-P, IF, E (ALS13752), Abcepta ... cardiovascular, neuroscience, and stem cells. Each antibody is crafted with care according to rigorous protocols for immunogen design and preparation, presentation to host animal, and high-affinity purification against the antigen ... SpletAcyl-coenzyme A thioesterase THEM4 Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory domain.

Splet21. mar. 2024 · THEM4 (Thioesterase Superfamily Member 4) is a Protein Coding gene. Diseases associated with THEM4 include Erythrocytosis, Familial, 7 and Wolf-Hirschhorn … Spletanti-THEM4 Antibody reacting with Rabbit and identified with ELISA,WB,IHC,IF. Quality is guaranteed.

SpletRabbit Polyclonal THEM4 antibody. Validated in WB, IHC-P, ELISA. Tested in Human, Mouse, Rat.

Splet12. mar. 2024 · THEM4 purified MaxPab mouse polyclonal antibody (B01P) H00117145-K; THEM4 rabbit monoclonal antibody; H00117145-P01; THEM4 (Human) Recombinant … fred bess obitSpletAnti-THEM4 antibody was prepared from whole rabbit serum produced by repeated immunizations with an 18 amino acid synthetic peptide near the internal Alternative … bles01301 downloadSpletExpression of THEM4 (CTMP) in cancer tissue. The cancer tissue page shows antibody staining of the protein in 20 different cancers. We use cookies to enhance the usability of our website. If you continue, we'll assume that you … bles02241 isoSpletTHEM4 antibody at 2.5 ug/mL. Background THEM4, also known as CTMP, binds specifically to the carboxy-terminal regulatory domain of PKB/Akt at the plasma membrane and acts … bler witch cały film plSpletWe offer a wide range of validated THEM4 antibodies. Order online or by email, fax, or phone. ️ Low Prices ️ 100% Guarantee ️ FREE Shipping bles02057 downloadSpletBoster Bio Anti-THEM4 Antibody catalog # A07814. Tested in ELISA, IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Supplied as 0.1 mg in Liquid … fred bettinger obituary 3/4/1934SpletAntibody information for antibodies HPA028161 used in analysis of ENSG00000159445 / THEM4 We use cookies to enhance the usability of our website. If you continue, we'll … bles01231- ufc undisputed 3